PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01411.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 366aa    MW: 41995.4 Da    PI: 7.1198
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01411.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1377.5e-1280112335
                              XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekv 35 
                              ++k +rr+++NReAAr+sR+RKka++++Le+  
  Rsa1.0_01411.1_g00007.1  80 PDKTQRRLAQNREAARKSRLRKKAYVQQLETSR 112
                              689**************************9854 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-578142IPR004827Basic-leucine zipper domain
PfamPF001702.9E-980110IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.7680122IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.63E-782122No hitNo description
Gene3DG3DSA:1.20.5.1704.9E-882123No hitNo description
PROSITE patternPS00036085100IPR004827Basic-leucine zipper domain
PfamPF141445.5E-30168243IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MNTYTTTSSH FVPPTRFEIY DPLNQISTMW EESFKNNNGG FYTPNSVIIP SNEKPDSLSE  60
DGTGGTPHKF DQEASTSRHP DKTQRRLAQN REAARKSRLR KKAYVQQLET SRLKLIHLEQ  120
ELDRARQQGF YASNRVDTNP LSFPDDMGSG IVAFEMEYGH WVEKQNRQIS ELRSVLHGQV  180
SDVELRLLVD NAMKHYFQLF RMKSAAAKLD VFYIMSGMWK TSAERFFLWI GGFRPSELLK  240
VLLPHFDPMM DQQVLDVCNL RQSCQQAEDA VSQGMEKLQH TLAESVAAGE LGEGSYVPQI  300
TCAIERLEAL VSFVNQADNL RHETLQQMHR ILTTRQAARG LLALGEYFQR LRALSSSWET  360
RQREPT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3530850.0AK353085.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-10-F22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009122096.10.0PREDICTED: transcription factor TGA4
RefseqXP_009122097.10.0PREDICTED: transcription factor TGA4
RefseqXP_013715712.10.0PREDICTED: transcription factor TGA4-like
RefseqXP_013715713.10.0PREDICTED: transcription factor TGA4-like
RefseqXP_013715714.10.0PREDICTED: transcription factor TGA4-like
SwissprotQ391620.0TGA4_ARATH; Transcription factor TGA4
TrEMBLA0A078BYP20.0A0A078BYP2_BRANA; BnaA10g22150D protein
TrEMBLQ4ABR50.0Q4ABR5_BRARP; 80A08_2
STRINGBra009063.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29762766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.20.0TGACG motif-binding factor 4